FAM18B2 (TVP23C) Rabbit Polyclonal Antibody TA330862 from OriGene Technologies | Biocompare.com

Supplier Images

FAM18B2 (TVP23C) Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
FAM18B2 (TVP23C) Rabbit Polyclonal Antibody

The FAM18B2 (TVP23C) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to TVP23C-CDRT4. This antibody recognizes Human antigen. The FAM18B2 (TVP23C) Rabbit Polyclonal Antibody has been validated for the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-TVP23C Antibody

Product Specs
ItemFAM18B2 (TVP23C) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA330862
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
ReactivityHuman
TargetTVP23C
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-TVP23C antibody is: synthetic peptide directed towards the middle region of Human TVP23C. Synthetic peptide located within the following region: RWWNHIDEDGKSHWVFESRKESSQENKTVSEAESRIFWLGLIACSVLWVI
NCBI Full Gene NameTVP23C-CDRT4 readthrough, trans-golgi network vesicle protein 23 homolog C
NCBI Gene AliasesFAM18B2, FAM18B2-CDRT4, TVP23C
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!